ホーム 計算ツール
代理店ログイン

検索結果

Search Results for " Exendin-4 peptide derivative "

6

阻害剤

37

リコンビナントタンパク質

カタログ番号 製品名 別名 ターゲット
TP1161 Exendin-4 peptide derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
TP1154 Exendin-4 peptide derivative acetate GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS,Exendin-4 peptide derivative
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative.
T75859 FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
T75860 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
TP1366 Exendin-3/4 (59-86)
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.
T36760 KQMEEEAVRLFIEWLKNGGPSSGAPPPS
KQMEEEAVRLFIEWLKNGGPSSGAPPPS is a Exendin-4 peptide derivative. Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon rec...

Recombinant Proteins

カタログ番号 製品名 Species Expression System
TMPJ-00864 VEGF165 Protein, Human, Recombinant Human HEK293 Cells
Human Vascular endothelial growth factor (VEGF), also known as VEGF-A and vascular permeability factor (VPF), belongs to the platelet-derived growth factor family of cysteine-knot growth factors. It is a potent activator...
TMPY-00749 FGF-2 Protein, Human, Recombinant Human E. coli
FGF-2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 16.5 kDa and the accession number is P09038-4.
TMPK-00823 VEGF165 Protein, Human, Recombinant (His & Avi) Human HEK293 Cells
Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. VEGF165 appears to be the most a...
TMPY-04911 VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated Human,Cynomolgus HEK293 Cells
VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 23.1 kDa and the accession number is P15692-4.
TMPY-02893 NT5C3A/NT5C3 Protein, Human, Recombinant Human E. coli
NT5C3A (5'-Nucleotidase, Cytosolic IIIA) is a Protein Coding gene. This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded prot...
TMPK-00423 CD45 Protein, Human, Recombinant (His & Avi) Human HEK293 Cells
PTPRC (also known as CD45),T cells require the protein tyrosine phosphatase CD45 to detect and respond to antigen because it activates the Src family kinase Lck, which phosphorylates the T cell antigen receptor (TCR) com...
TMPK-00822 VEGF165 Protein, Human, Recombinant (His & Avi), FITC-Labeled Human HEK293 Cells
Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. VEGF165 appears to be the most a...
TMPY-04754 CASK Protein, Human, Recombinant Human Baculovirus Insect Cells
CASK Protein, Human, Recombinant is expressed in Baculovirus insect cells. The predicted molecular weight is 102.1 kDa and the accession number is O14936-4.
TMPY-01822 PTK9 Protein, Human, Recombinant (His & GST) Human E. coli
PTK9 Protein, Human, Recombinant (His & GST) is expressed in E. coli expression system with His and GST tag. The predicted molecular weight is 57 kDa and the accession number is Q12792-4.
TMPY-04471 APEG1 Protein, Human, Recombinant (His) Human E. coli
Striated muscle preferentially expressed protein kinase, also known as aortic preferentially expressed protein 1, APEG-1, SPEG and KIAA1297, is a protein that belongs to the protein kinase superfamily and CAMK Ser/Thr pr...
TMPK-00424 CD45 Protein, Human, Recombinant (His & Avi), Biotinylated Human HEK293 Cells
PTPRC (also known as CD45),T cells require the protein tyrosine phosphatase CD45 to detect and respond to antigen because it activates the Src family kinase Lck, which phosphorylates the T cell antigen receptor (TCR) com...
TMPJ-00782 Amyloid Precursor Protein, Human, Recombinant (hFc) Human HEK293 Cells
Amyloid precursor protein (APP) is a type I membrane protein with several isoforms due to alternative splicing, performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and...
TMPY-01033 IL-32 Protein, Human, Recombinant (isoform alpha, His) Human HEK293 Cells
IL-32 is a recently discovered cytokine that induces various proinflammatory cytokines (TNF-alpha, IL-1beta, IL-6) and chemokines in both human and mouse cells through the NF-kappaB and p38 MAPK inflammatory signal pathw...
TMPY-01117 MRAP Protein, Human, Recombinant (hFc) Human HEK293 Cells
MRAP (Melanocortin 2 Receptor Accessory Protein) is a Protein Coding gene. This gene encodes a melanocortin receptor-interacting protein. It belongs to the MRAP family. MRAP, which contains a single transmembrane domain,...
TMPJ-00233 CD200R1/CRTR2 Protein, Human, Recombinant (His) Human HEK293 Cells
Cell surface glycoprotein CD200 Receptor 1 (CD200R1) is the receptor for the CD200 (OX-2) membrane glycoprotein. CD200R1 contains one C2- type Ig-like domain and one V-type Ig-like domain within its extracellular domain ...
TMPJ-00410 CD45R0 Protein, Human, Recombinant (His) Human HEK293 Cells
CD45R0 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 80-120 KDa and the accession number is P08575-4.
TMPY-00380 ANTXR2 Protein, Human, Recombinant (hFc) Human HEK293 Cells
ANTXR2 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 57.4 kDa and the accession number is P58335-4.
TMPY-05598 Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated Human HEK293 Cells
Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated is expressed in HEK293 mammalian cells with hFc and Avi tag. The predicted molecular weight is 103.7 kDa and the accession number is P20273-4.
TMPY-04565 SRPK3 Protein, Human, Recombinant (His & GST) Human Baculovirus Insect Cells
Serine / threonine-protein kinase SRPK3, also known as Muscle-specific serine kinase 1, Serine/arginine-rich protein-specific kinase 3, SR-protein-specific kinase 3, Serine / threonine-protein kinase 23, MSSK-1, SRPK3 an...
TMPY-01823 PTK9 Protein, Human, Recombinant Human E. coli
PTK9 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 29 kDa and the accession number is Q12792-4.
TMPY-00225 CLEC9A Protein, Mouse, Recombinant (hFc) Mouse HEK293 Cells
CLEC9A Protein, Mouse, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 52.1 kDa and the accession number is Q8BRU4-4.
TMPJ-01188 CORO6 Protein, Human, Recombinant (His) Human E. coli
Coronin 6, a newly identified member of the coronin family, is highly enriched at adult NMJs and regulates AChR clustering via modulating the interaction between receptors and the actin cytoskeletal network. Coronins are...
TMPY-00119 FLT1 Protein, Human, Recombinant (hFc) Human HEK293 Cells
FLT1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 61.1 kDa and the accession number is P17948-4.
TMPJ-01333 TEM8/ANTXR1 Protein, Human, Recombinant (His) Human HEK293 Cells
Anthrax Toxin Receptor 1 (ANTXR1) is a single-pass type I membrane protein that belongs to the ATR family. ANTXR1 contains one VWFA domain and binds PA through the VWA domain. ANTXR1 is highly expressed in tumor endothel...
TMPY-04563 CASK Protein, Human, Recombinant (His & GST) Human Baculovirus Insect Cells
CASK Protein, Human, Recombinant (His & GST) is expressed in Baculovirus insect cells with His and GST tag. The predicted molecular weight is 130 kDa and the accession number is O14936-4.
TMPJ-01256 Caspase-10 Protein, Human, Recombinant (His) Human E. coli
Caspase-10 (CASP10) is a 521 amino acid protein member of the Cysteine-Aspartic Acid Protease (Caspase) family. CASP10 contains two DED (Death Effector) domains and is detectable in most tissues. CASP10 cleavage by Granz...
TMPK-00702 ANTXR2 Protein, Human, Recombinant (His) Human HEK293 Cells
The Capillary Morphogenesis Gene 2 (CMG2) gene encodes an Anthrax toxin receptor (ANTXR2),ANTXR2/CMG2 was originally identified as a result of up-regulation during capillary morphogenesis of endothelial cells (ECs) cultu...
TMPY-01933 CHI3L2 Protein, Human, Recombinant (His) Human HEK293 Cells
Chondrocyte protein 39 (YKL-39), also known as Chitinase 3-like 2 (CHI3L2), is a secretory protein of articular chondrocytes belonging to the glycosyl hydrolase 18 family. Its highest expression is in chondrocytes, follo...
TMPY-00711 CD45 Protein, Human, Recombinant (hFc) Human HEK293 Cells
CD45 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 71.1 kDa and the accession number is P08575-4.
TMPK-01356 SIRP alpha V4 Protein, Human, Recombinant (His & Avi) Human HEK293 Cells
Signal regulatory protein α (SIRPα) is a regulatory membrane glycoprotein from SIRP family expressed mainly by myeloid cells and also by stem cells or neurons.SIRPα acts as inhibitory receptor and interacts with a broadl...
TMPK-01362 SIRP alpha V4 Protein, Human, Recombinant (His & Avi), Biotinylated Human HEK293 Cells
Signal regulatory protein α (SIRPα) is a regulatory membrane glycoprotein from SIRP family expressed mainly by myeloid cells and also by stem cells or neurons.SIRPα acts as inhibitory receptor and interacts with a broadl...
TMPK-01505 HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi), Biotinylated Human HEK293 Cells
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KD...
TMPK-01492 HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi) Human HEK293 Cells
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity i...
TMPK-01501 HLA-A*02:01&B2M&HBV (FLLTRILTI) Tetramer Protein, Human, MHC (His & Avi) Human HEK293 Cells
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity i...
TMPK-01491 HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi), Biotinylated Human HEK293 Cells
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity i...
TMPK-01504 HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Tetramer Protein, Human, MHC (His & Avi) Human HEK293 Cells
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KD...
TMPK-01506 HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi) Human HEK293 Cells
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KD...
VEGF165 Protein, Human, Recombinant
TMPJ-00864
Species: Human
Expression System: HEK293 Cells
FGF-2 Protein, Human, Recombinant
TMPY-00749
Species: Human
Expression System: E. coli
VEGF165 Protein, Human, Recombinant (His & Avi)
TMPK-00823
Species: Human
Expression System: HEK293 Cells
VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated
TMPY-04911
Species: Human,Cynomolgus
Expression System: HEK293 Cells
NT5C3A/NT5C3 Protein, Human, Recombinant
TMPY-02893
Species: Human
Expression System: E. coli
CD45 Protein, Human, Recombinant (His & Avi)
TMPK-00423
Species: Human
Expression System: HEK293 Cells
VEGF165 Protein, Human, Recombinant (His & Avi), FITC-Labeled
TMPK-00822
Species: Human
Expression System: HEK293 Cells
CASK Protein, Human, Recombinant
TMPY-04754
Species: Human
Expression System: Baculovirus Insect Cells
PTK9 Protein, Human, Recombinant (His & GST)
TMPY-01822
Species: Human
Expression System: E. coli
APEG1 Protein, Human, Recombinant (His)
TMPY-04471
Species: Human
Expression System: E. coli
CD45 Protein, Human, Recombinant (His & Avi), Biotinylated
TMPK-00424
Species: Human
Expression System: HEK293 Cells
Amyloid Precursor Protein, Human, Recombinant (hFc)
TMPJ-00782
Species: Human
Expression System: HEK293 Cells
IL-32 Protein, Human, Recombinant (isoform alpha, His)
TMPY-01033
Species: Human
Expression System: HEK293 Cells
MRAP Protein, Human, Recombinant (hFc)
TMPY-01117
Species: Human
Expression System: HEK293 Cells
CD200R1/CRTR2 Protein, Human, Recombinant (His)
TMPJ-00233
Species: Human
Expression System: HEK293 Cells
CD45R0 Protein, Human, Recombinant (His)
TMPJ-00410
Species: Human
Expression System: HEK293 Cells
ANTXR2 Protein, Human, Recombinant (hFc)
TMPY-00380
Species: Human
Expression System: HEK293 Cells
Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPY-05598
Species: Human
Expression System: HEK293 Cells
SRPK3 Protein, Human, Recombinant (His & GST)
TMPY-04565
Species: Human
Expression System: Baculovirus Insect Cells
PTK9 Protein, Human, Recombinant
TMPY-01823
Species: Human
Expression System: E. coli
CLEC9A Protein, Mouse, Recombinant (hFc)
TMPY-00225
Species: Mouse
Expression System: HEK293 Cells
CORO6 Protein, Human, Recombinant (His)
TMPJ-01188
Species: Human
Expression System: E. coli
FLT1 Protein, Human, Recombinant (hFc)
TMPY-00119
Species: Human
Expression System: HEK293 Cells
TEM8/ANTXR1 Protein, Human, Recombinant (His)
TMPJ-01333
Species: Human
Expression System: HEK293 Cells
CASK Protein, Human, Recombinant (His & GST)
TMPY-04563
Species: Human
Expression System: Baculovirus Insect Cells
Caspase-10 Protein, Human, Recombinant (His)
TMPJ-01256
Species: Human
Expression System: E. coli
ANTXR2 Protein, Human, Recombinant (His)
TMPK-00702
Species: Human
Expression System: HEK293 Cells
CHI3L2 Protein, Human, Recombinant (His)
TMPY-01933
Species: Human
Expression System: HEK293 Cells
CD45 Protein, Human, Recombinant (hFc)
TMPY-00711
Species: Human
Expression System: HEK293 Cells
SIRP alpha V4 Protein, Human, Recombinant (His & Avi)
TMPK-01356
Species: Human
Expression System: HEK293 Cells
SIRP alpha V4 Protein, Human, Recombinant (His & Avi), Biotinylated
TMPK-01362
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi), Biotinylated
TMPK-01505
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi)
TMPK-01492
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HBV (FLLTRILTI) Tetramer Protein, Human, MHC (His & Avi)
TMPK-01501
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi), Biotinylated
TMPK-01491
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Tetramer Protein, Human, MHC (His & Avi)
TMPK-01504
Species: Human
Expression System: HEK293 Cells
HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi)
TMPK-01506
Species: Human
Expression System: HEK293 Cells